General Information

  • ID:  hor005529
  • Uniprot ID:  Q23755
  • Protein name:  PDH precursor-related peptide 1
  • Gene name:  PDH1
  • Organism:  Callinectes sapidus (Blue crab)
  • Family:  Arthropod PDH family
  • Source:  animal
  • Expression:  Eyestalk sinus gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Callinectes (genus), Portuninae (subfamily), Portunidae (family), Portunoidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  QELKYQEREMVAELAQQIYRVAQAPWAAAVGPH
  • Length:  33(23-55)
  • Propeptide:  MRSSVIVAVLVVVALAALLTQGQELKYQEREMVAELAQQIYRVAQAPWAAAVGPHKRNSELINSILGLPKVMNDAGRR
  • Signal peptide:  MRSSVIVAVLVVVALAALLTQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neurom
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q23755-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005529_AF2.pdbhor005529_ESM.pdb

Physical Information

Mass: 435328 Formula: C169H262N48O49S
Absent amino acids: CDFNST Common amino acids: A
pI: 5.64 Basic residues: 4
Polar residues: 3 Hydrophobic residues: 14
Hydrophobicity: -46.97 Boman Index: -5010
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 83.03
Instability Index: 1734.55 Extinction Coefficient cystines: 8480
Absorbance 280nm: 265

Literature

  • PubMed ID:  7999056
  • Title:  Molecular cloning of two pigment-dispersing hormone (PDH) precursors in the blue crab Callinectes sapidus reveals a novel member of the PDH neuropeptide family.